rProTx-I
- 貨號 Cat. No.
- RTP-200
- 規格 Size
- 5 μg 5x5 μg 10μg 5x10μg 0.1mg
Description
rProTx-I
Potent Blocker of Nav and Cav3 Channels.
| Product#: | RTP-200 |
| Sizes: |
| 5 µg |
| 5 x 5 µg |
| 10 µg |
| 5 x 10 µg |
| 0.1 mg |
| M.W.: | 3987.5 da |
| Sequence: | ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS |
| Purity: | >98% |
| Bioassay: |
rProTx-I inhibits the current of Nav1.5 channel stably expressed in 293 HEK cells. |
 |
Superimposed traces of hNav1.5 currents measured in stably transfected HEK 293 cells using whole-cell voltage clamp technique under control (black) conditions and following 100 sec perfusion with 10nM, 25nM, 50nM and 100nM rProtoxin-I (#RTP-200) as indicated. Nav1.5 currents were elicited by 50 ms long voltage ramp from the resting potential of -100mV to +60 mV, delivered every 10 sec. |
Native ProTx-I has been isolated from the venom of the tarantula Thrixopelma pruriens. It was purified on the basis of its ability to reversibly inhibit the tetrodotoxin (TTX)-resistant Na channel Nav1.8. Structurally, ProTx-I is shown to belong to the inhibitory cystine knot (ICK) family of peptidyl toxins interacting with voltage-gated ion channels. ProTx-I was also found to be an inhibitor for TTX sensitive Nav channels such Nav1.5, Nav1.7 and Nav1.3 with IC50 values below 100nM. Furthermore, ProTx-I shifts the voltage dependence activity of Cav 3.1 a(1G), (IC50 ~50 nM) without affecting the voltage dependence of inactivation.1,2
Alomone Labs is pleased to offer rProTx-I, a recombinant peptide expressed in and extracted from E. coli and purified to homogeneity.