rCalciseptine
- 貨號 Cat. No.
- RTC-500
- 規格 Size
- 0.1 mg 5x0.1mg
Description
rCalciseptine
L-Type Cav Channel Blocker
| Product#: | RTC-500 |
| Sizes: |
| 0.1 mg |
| 5 x 0.1 mg |
| M.W.: | 7167.4 Daltons |
| Sequence: | MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK |
| Purity: | >98% by HPLC |
| Bioassay: |
rCalciseptine block L-type Ca2+ current in Xenopus oocyte. |
 |
L-type Ca2+ channels (Cav1.2, b3) heterologously expressed in Xenopus oocyte and activated by depolarizing step before and during application of 300 nM rCalciseptine (#RTC-500). Left: I-V relationship. Right: traces of control and inhibited current. |
Natural Calciseptine is a peptidyl toxin originally isolated from the Dendroaspis p. polylepsis black mamba venom 1. Calciseptine was shown to be a specific L-type Cav channel blocker.2 In contrast, it increases L-type currents in skeletal muscle.3 Calciseptine blocks spontaneous or K+-induced contraction of cardiac and smooth muscle cells.2 Using patch clamp, it was also shown to block specifically L-type Cav channel current in neuronal cells in culture.2 For these variety of effects, the IC50's were in the range of 15-500 nM. Using the outside-out configuration of patch clamp, it was shown to reduce single L-type channels open probability and availability as recorded from Guinea pig portal vein.4
rCalciseptine is a recombinant peptide expressed in and extracted from E. coli, purified to homogeneity and confirmed by mass spectrometry analysis. The rCalciseptine contains an additional methionine at the N-terminus.
The ability of rCalcoseptine to block L-type Ca2+ current is tested in Xenopus oocyte and found similar to that of natural Calciseptine (C-500). This proves that this modification does not affect its activity properties.
Alomone Labs is pleased to offer rCalciseptine, an economical product at a very attractive price.