rAPETx2 A Blocker of ASIC3 Channel
- 貨號 Cat. No.
- RTA-100
- 規格 Size
- 5 µg 5 x 5 µg 10 µg 5x10 µg 0.1mg
Description
rAPETx2
A Blocker of ASIC3 Channel
| Product#: | RTA-100 |
| Sizes: |
| 5 µg |
| 5 x 5 µg |
| 10 µg |
| 5 x 10 µg |
| 0.1 mg |
| M.W.: | 4561 Da. |
| Sequence: | GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD. |
| Purity: | >98%. |
| Bioassay: |
| rAPETx2 blocks inward currents of ASIC3 channels expressed in Xenopus oocytes. |
 |
| Membrane potential was held at 5 mV and whole cell current was continuously recorded. ASIC3 currents were elicited by rapid exposure to pH 5 in physiological solution every 20 sec. 1 然 rAPETx2 (#RTA-100) was introduced into the bath via perfusion, resulting in a reversible inhibition of the pH dependent inward transients. |
Natural APETx2 is a 42-amino-acid peptidyl toxin, originally isolated from the sea anemone Anthopleura elegantissima. APETx2 was shown to be a selective, potent and reversible blocker of the homodimer proton gated channel ASIC3. ASIC3 has been implicated in pain transduction associated with acidosis in inflamed or ischemic tissues. APETx2 directly inhibits the ASIC3 channel by acting at its external side of the channel in a pH dependent manner.
APETx2 also inhibits the hetromer ASIC2b-ASIC3 channel but does not inhibit the activity of ASIC1 isoform1.
Structurally APETx2 is related to APETx1 a toxin that targets HERG K+ channel1,2.
Alomone Labs is pleased to offer rAPETx2, a recombinant protein expressed and purified from E. coli.