Rabbit polyclonal antibody to Synapsin I/SYNI: Affinity purified
Antibodies
- 貨號 Cat. No.
- R-1829-100
- 規格 Size
- 100 ug
- 品牌 Brand
- Biosensis
- Application 應用
- IH(P), Paraffin embedded 、 WB
- Reactivity
- Human 、 Mouse 、 Rat
- Host
- Rabbit
- Clonality
- Polyclonal
Description
ZZZZ_Status (Active, Disc) : Active
AA_Supplier Name : Biosensis
Alternative_Name (Other Names) :
Synapsin-1; Brain protein 4.1; Synapsin I; SYN1
Antibody_Isotype
(Antibody only) : IgG
Application_Details :
Western Blot (0.1-0.5 ug/mL): tested in SHG-44 cell lysate (human malignant glioma cell line), mouse and rat brain lysates, and rat cell line. Immunohistochemistry (0.5-1.0 ug/mL): tested in formalin fixed, paraffin embedded human glioma tissue with HEIR. Other applications not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Background_Info :
Clone_Name
(AB only, monoclonals) :
Datasheet_Link : http://www.biosensis.com/pdf_datasheet.php?products_id=1659
Description (Long Description) :
The synapsins are a family of proteins that have long been implicated in the regulation of neurotransmitter release at synapses. Specifically, they are thought to be involved in regulating the number of synaptic vesicles available for release via exocytosis at any one time. Synapsins are present in invertebrates and vertebrates and are somewhat homologous across evaluated vertebrates. (Ref: Pfam.org)
Expiry_Date :
12 months after date of receipt unopened.
Format (Form) :
Lyophilized
Immunogen (Antigen) :A synthetic peptide corresponding to a sequence at the C-terminus of human Synapsin I (662-705aa KSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASL FSD), identical to the related mouse and rat sequences.
Kit_Components :
MSDS (File name) :
