Rabbit polyclonal antibody to Presenilin 2 loop region: IgG

ZZZZ_Status (Active, Disc) : Active

 

AA_Supplier Name : Biosensis

 

Alternative_Name (Other Names) :

AD3LP, AD5, E5-1, STM-2

 

Antibody_Isotype
(Antibody only) : IgG

 

Application_Details :

WB and IP. Suggested dilution of 1:1,000 is recommended for WB. Full length presenilin 2 (448 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 22 kDa with this antibody. Human or mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. The suggested dilution for IP is 1:100 . Biosensis recommends that the optimal working dilution should be determined by the end user.

 

Background_Info :

 

Clone_Name
(AB only, monoclonals) :

 

Datasheet_Link : http://www.biosensis.com/pdf_datasheet.php?products_id=1256

 

Description (Long Description) : 

Autosomal dominant mutations in presenilin 2 are the second major cause of early-onset familial Alzheimer's disease. Presenilin 2 is a multi-transmembrane protein which undergoes endoprotelysis to form an N-terminal fragment of about 29 kDa and C-terminal fragment of about 22 kDa. Presenilin 2 forms the catalytic core of the gamma-secretase complex which cleaves type 1 transmembrane proteins including the amyloid precursor protein to generate the C-terminus of the amyloid beta peptide.

 

Expiry_Date : 

12 months after purchase

 

Format (Form) : 

Lyophilized from PBS, pH 7.4. Contains no preservative.

 

Immunogen (Antigen) :A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.

 

Kit_Components :

 

MSDS (File name) :