Rabbit polyclonal antibody to Hypoxia-inducible factor-2 alpha (202-240): Affinity purified

ZZZZ_Status (Active, Disc) : Active

 

AA_Supplier Name : Biosensis

 

Alternative_Name (Other Names) :

Endothelial PAS domain-containing protein 1; EPAS-1; Hypoxia-inducible factor 2 alpha; HIF-2 alpha; HIF2 alpha; Epas1; Hif2a;

 

Antibody_Isotype
(Antibody only) :

 

Application_Details :

Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Rat HIF-2 alpha has a predicted length of 874 residues and MW of 97 kDa. A concentration of 0.5-1.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues as well as formalin/acetone fixed frozen tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.

 

Background_Info :

 

Clone_Name
(AB only, monoclonals) :

 

Datasheet_Link : http://www.biosensis.com/pdf_datasheet.php?products_id=583

 

Description (Long Description) : 

Hypoxia-inducible factor-2 alpha (HIF-2 alpha) is a transcription factor involved in the induction of oxygen regulated genes. HIF-2 alpha binds to a specific core DNA sequence within the hypoxia response element of target gene promoters.

 

Expiry_Date : 

12 months after purchase

 

Format (Form) : 

Lyophilized with 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3

 

Immunogen (Antigen) :A synthetic peptide (YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD) corresponding to a region (202-240) from rat Hypoxia-inducible factor-2 alpha. To enhance the immunological response, this peptide was coupled to carrier protein BSA.

 

Kit_Components :

 

MSDS (File name) :