Rabbit polyclonal antibody to human Integrin beta-2 (24-58): Affinity purified

ZZZZ_Status (Active, Disc) : Active

 

AA_Supplier Name : Biosensis

 

Alternative_Name (Other Names) :

ITGB2; CD18; MF17; ITB2;

 

Antibody_Isotype
(Antibody only) :

 

Application_Details :

Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0-2.0 µg/mL is recommended for WB. Human integrin beta-2 has a predicted length of 769 amino acids and a MW of 85 kDa. A concentration of 1.0-2.0 µg/mL is recommended to detect Integrin beta-2 in formalin fixed and paraffin embedded tissues. Antigen retrieval is required. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.

 

Background_Info :

 

Clone_Name
(AB only, monoclonals) :

 

Datasheet_Link : http://www.biosensis.com/pdf_datasheet.php?products_id=483

 

Description (Long Description) : 

Integrins are cell-surface proteins with important roles in cell adhesion, migration and cell surface mediated signalling. The integrin family contains at least 18 alpha and 8 beta subunits that form alpha/beta heterodimers. The integrin beta-2 subunit is also known as CD18 or ITGB2. Integrin beta-2 associates with the alpha-L subunit to form the LFA1 integrin which is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. It combines with the alpha-M subunit to form the Mac1 integrin. Integrin beta-2 also associates with the alpha-X and alpha-D subunits.

 

Expiry_Date : 

12 months after purchase

 

Format (Form) : 

Lyophilized with 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3

 

Immunogen (Antigen) :A synthetic peptide (ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD) corresponding to a region (24-58) from human integrin beta-2. To enhance the immunological response, this peptide was coupled to carrier protein BSA.

 

Kit_Components :

 

MSDS (File name) :