ProTx-II A Blocker of Nav1.7 and Nav1.5 Channels
- 貨號 Cat. No.
- STP-100
- 規格 Size
- 5 µg 5 x 5 µg 10 µg 5x10 µg 0.1mg
Description
ProTx-II
A Blocker of Nav1.7 and Nav1.5 Channels
| Product#: | STP-100 |
| Sizes: |
| 5 µg |
| 5 x 5 µg |
| 10 µg |
| 5 x 10 µg |
| 0.1 mg |
| M.W.: | 3832.6 Da. |
| Sequence: | YCKWMWTCDSERKCCEGMVCRLWCKKKLW. |
| Purity: | >98%. |
| Bioassay: |
ProTx-II blocks human Na v1.5 current stably expressed in HEK-293 cells. |
 |
hNa v1.5 currents were elicited by 50 ms voltage ramp from the holding potential of -100 mV to +60 mV, applied every 10 sec using whole-cell voltage clamp technique. Left: Superimposed traces of hNav1.5 currents measured under control conditions and after 100 sec perfusion with 50, 100 and 200 nM ProTx-II (#STP-100), as indicated. Inset: Time course of hNav1.5 current amplitude change as a result of 10, 25, 50, 100 and 200 nM ProTx-II application, as indicated by the horizontal bars. Right: ProTx-II dose response of hNav1.5 currents (n = 3). |
ProTx-II is a peptidyl toxin originally produced in Thrixopelma pruriens, the Peruvian green velvet tarantula. It was identified as a voltage-gated Na+ channel (Nav) blocker which inhibits both tetrodotoxin-sensitive and tetrodotoxin-resistant channels1.
Binding of ProTx-II to an extracelluar domain of Nav channel, probably to a hydrophobic site3, inhibits current by shifting the channel activation to more positive potentials1-2.
ProTx-II Inhibits Nav1.2, Nav1.3, Nav1.5 , Nav1.6 , Nav1.7 and, Nav1.8. It is a significantly more potent inhibitor against Nav 1.7 than the other Nav channel subtypes1.
ProTx-II was also found as an effective modulator which shifts the voltage dependence activity of T-type Ca2+ channel1.
Alomone labs is pleased to offer ProTx-II, a highly purified synthetic protein.