Phrixotoxin-3
- 貨號 Cat. No.
- P-720
- 規格 Size
- 5 μg 5x5 μg 10μg 5x10μg 0.1mg
Description
Phrixotoxin-3
Potent Blocker of NaV1.2 Channel
| Product#: | P-720 |
| Sizes: |
| 5 µg |
| 5 x 5 µg |
| 10 µg |
| 5 x 10 µg |
| 0.1 mg |
| M.W.: | 4060 Da |
| Sequence: | DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI |
| Purity: | >99% |
| Bioassay: |
Phrixotoxin-3 (# P-720) inhibits the Na+ current of NaV1.2 channel expressed in Xenopus oocyte |
 |
Legened: Superimposed traces of Nav1.2 channel current before (green) and during (black) application of 300 nM phrixotoxin-3. Current were elicited from holding potential -100 by voltage ramps of 35 ms to +60mV, delivered every 5 seconds. |
phrixotoxin-3 is a native peptidyl toxin isolated from the venom of the tarantula Phrixotrichus auratus. This toxin is highly specific and potent blocker for voltage-gated Na+ channels especially the neuronal channel Nav1.2 with properties similar to those of typical gating-modifier toxins, by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current.1
Injection of phrixotoxin-3 to mice caused neurotoxicity symptoms that expressed by general ataxia, lack of response to stimuli, and semiparalysis.1
Alomone Labs is pleased to offer Phrixotoxin-3, a natural native toxin purified to homogeneity from the venom of the tarantula Phrixotrichus auratus .