Mouse monoclonal antibody to NeuN/Fox3 [1B7] (1-99): IgG

pnbsp;/p
table border=0 cellspacing=0 cellpadding=3 style=color: rgb(0, 0, 0); font-size: 16px;
tbody style=line-height: normal;
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Description/b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;span style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px; itemprop=descriptionFox3 is one of a family of mammalian homologues of Fox-1. The Fox proteins are about 46kDa in size, and each includes a central highly conserved RRM type RNA recognition motif. Much interest has focused on Fox3 as a result of the recent finding that this protein corresponds to NeuN, a neuronal nuclear antigen. NeuN/Fox-3 has a function in RNA splicing and is expressed heavily and specifically in neuronal nuclei and cytoplasm. Our antibody was raised against the N-terminal 100 amino acids of human Fox3 as expressed in and purified from E. coli. We did not use full length Fox3 as immunogen since the three mammalian Fox homologues, namely Fox1, Fox2 and Fox3, include virtually identical RRM motifs. The N-terminal region of the three molecules are much more variable in the three molecules so antibodies specific for each of the three molecules can therefore be generated.br style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px; /
/span/td
/tr
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Batch No./b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;See product label/td
/tr
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Unit size/b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;100 micro;L/td
/tr
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Antigen/b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;Antibody was raised against the N-terminal 100 amino acids of human Fox3 as expressed in and purified from E. coli./td
/tr
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Sequence/b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGS EASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR/td
/tr
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Antigen Location/b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;1-99/td
/tr
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Antigen Length/b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;100/td
/tr
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Antibody Type/b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;Monoclonal/td
/tr
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Isotype/b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;IgG2a/td
/tr
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Clone/b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;1B7/td
/tr
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Other Names/b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;Feminizing locus on X; Fox-1; Fox3; NeuN;/td
/tr
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Accession/b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;a href=http://www.uniprot.org/uniprot/A6NFN3 target=_blank style=color: rgb(0, 51, 204); text-decoration-line: none;A6NFN3/a FOX1C_HUMAN;/td
/tr
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Produced in/b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;Mouse/td
/tr
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Applications/b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;Western Blotting (WB), Immunohistochemistry (IHC) and Immunocytochemistry (IC). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:1,000 is recommended for IHC. A dilution of 1:500 - 1:1,000 is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user./td
/tr
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Specificity/b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;The specificity of this antibody has been confirmed by WB. Two alternate transcripts can be seen at 46 kDa and 48 kDa./td
/tr
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Antibody Against/b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;NeuN/Fox3/td
/tr
tr style=line-height: normal;
td valign=top style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;b style=border-bottom: 0px none rgb(0, 0, 0); line-height: 16px; padding-bottom: 0px; padding-left: 0px; padding-top: 0px;Cross-reactivity/b/td
td style=border-bottom-color: rgb(204, 204, 204); font-size: 12.8px; line-height: 16px; padding-bottom: 3px; padding-left: 3px; padding-top: 2px;Hu, Rat, Ms, Bov, Porcine/td
/tr
/tbody
/table