HUMAN β-DEFENSIN 2(aa 4-41) ANTIBODY, MONOCLONAL

HUMAN β-DEFENSIN 2(aa 4-41) ANTIBODY, MONOCLONAL Catalog no.: AE 1110.1 / AE 1110.2 Immunogen: Synthetic human β-Defensin 2 (aa 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP) Synonyms: Beta-Defensin 2, beta 2, BD-2, Skin-antimicrobial peptide, SAP1 Swiss-Prot No: O15263 Gene Information: Gene Name: DEFB4 GeneID: 1673 Host: Mouse Balb-c Clone no.: L12-4C-C2 Isotype: IgG

For research use only

1 Matrix: Cell culture supernatant, protein G purified, 50 mM TRIS pH 7,4 Specificity: Synthetic human β-Defensin 2 (aa 4-41) Contents: 10 μg / 100 μg (lyophilized) resuspend in 10 μ / 100 μl aqua bidest Known applications: ELISA This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls. Store at: 2-8 °C (lyophilized); - 20 °C (dissolved) Repeated thawing and freezing must be avoided