HUMAN β-DEFENSIN 1 (aa 1-36) ANTIBODY, MONOCLONAL

HUMAN β-DEFENSIN 1 (aa 1-36) ANTIBODY, MONOCLONAL Catalog no.: AE 1109.1 / AE 1109.2 Immunogen: Synthetic human β-Defensin 1 (aa 1-36) (3 disulfide bridges) (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK) Synonyms: Beta-Defensin 1, beta 1, BD-1 Swiss-Prot No: P60022 Gene Information: Gene Name: DEFB1 GeneID: 1672 Host: Mouse Balb-c Clone no.: M4-14b-H4 Isotype: IgG1 Matrix: Cell culture supernatant, protein G purified, 50 mM TRIS pH 7,4 Specificity: Synthetic human β-Defensin 1 (aa 1-36) Contents: 10 μg / 100 μg (lyophilized) resuspend in 10 μ / 100 μl aqua bidest Known applications: ELISA, Western blot This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls. Store at: 2-8 °C (lyophilized); - 20 °C (dissolved) Repeated thawing and freezing must be avoided Reference: 1.Zucht HD, Grabowsky J, Schrader M, Liepke C, Jurgens M, Schulz-Knappe P, Forssmann WG. Human beta-defensin-1: A urinary peptide present in variant molecular forms and its putative functional implication. Eur J Med Res 1998;3:315-23.