Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum

ZZZZ_Status (Active, Disc) : Active

 

AA_Supplier Name : Biosensis

 

Alternative_Name (Other Names) :

Agrp; Agrt; Art; Agouti-related protein;

 

Antibody_Isotype
(Antibody only) : Mixed

 

Application_Details :

IHC, frozen, PFA fixed material. Not yet tested on paraffin embedded tissue sections. A concentration of 1:1000 to 1:2000 is recommended for IHC with overnight incubations. Permeabilization suggested is 0.1% triton X-100 in blocking buffer. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/mL of AGRP. In rodents such as rat cell terminal staining is most typically observed without cell body staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.

 

Background_Info :

 

Clone_Name
(AB only, monoclonals) :

 

Datasheet_Link : http://www.biosensis.com/pdf_datasheet.php?products_id=267

 

Description (Long Description) : 

AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.

 

Expiry_Date : 

12 months upon reconstitution

 

Format (Form) : 

Lyophilized

 

Immunogen (Antigen) :A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.

 

Kit_Components :

 

MSDS (File name) :